NPM3 purified MaxPab mouse polyclonal antibody (B01P)
  • NPM3 purified MaxPab mouse polyclonal antibody (B01P)

NPM3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010360-B01P
NPM3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NPM3 protein.
Información adicional
Size 50 ug
Gene Name NPM3
Gene Alias PORMIN|TMEM123
Gene Description nucleophosmin/nucleoplasmin, 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NPM3 (NP_008924.1, 1 a.a. ~ 178 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10360

Enviar uma mensagem


NPM3 purified MaxPab mouse polyclonal antibody (B01P)

NPM3 purified MaxPab mouse polyclonal antibody (B01P)