WARS2 MaxPab rabbit polyclonal antibody (D01)
  • WARS2 MaxPab rabbit polyclonal antibody (D01)

WARS2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010352-D01
WARS2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human WARS2 protein.
Información adicional
Size 100 uL
Gene Name WARS2
Gene Alias TrpRS
Gene Description tryptophanyl tRNA synthetase 2, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MALHSMRKARERWSFIRALHKGSAAAPALQKDSKKRVFSGIQPTGILHLGNYLGAIESWVRLQDEYDSVLYSIVDLHSITVPQDPAVLRQSILDMTAVLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFNKKYGEFFPVPESILSMCVLVFLT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen WARS2 (NP_957715.1, 1 a.a. ~ 220 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10352

Enviar uma mensagem


WARS2 MaxPab rabbit polyclonal antibody (D01)

WARS2 MaxPab rabbit polyclonal antibody (D01)