PCGF3 polyclonal antibody (A01)
  • PCGF3 polyclonal antibody (A01)

PCGF3 polyclonal antibody (A01)

Ref: AB-H00010336-A01
PCGF3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCGF3.
Información adicional
Size 50 uL
Gene Name PCGF3
Gene Alias DKFZp686D20235|DONG1|FLJ36550|FLJ43813|MGC129615|MGC40413|RNF3|RNF3A
Gene Description polycomb group ring finger 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SNKEAAEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCGF3 (NP_006306, 133 a.a. ~ 242 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10336

Enviar uma mensagem


PCGF3 polyclonal antibody (A01)

PCGF3 polyclonal antibody (A01)