TLR6 monoclonal antibody (M07), clone 4H3
  • TLR6 monoclonal antibody (M07), clone 4H3

TLR6 monoclonal antibody (M07), clone 4H3

Ref: AB-H00010333-M07
TLR6 monoclonal antibody (M07), clone 4H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TLR6.
Información adicional
Size 100 ug
Gene Name TLR6
Gene Alias CD286
Gene Description toll-like receptor 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLR6 (NP_006059, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10333
Clone Number 4H3
Iso type IgG2a Kappa

Enviar uma mensagem


TLR6 monoclonal antibody (M07), clone 4H3

TLR6 monoclonal antibody (M07), clone 4H3