B3GNT3 monoclonal antibody (M01), clone 1A2
  • B3GNT3 monoclonal antibody (M01), clone 1A2

B3GNT3 monoclonal antibody (M01), clone 1A2

Ref: AB-H00010331-M01
B3GNT3 monoclonal antibody (M01), clone 1A2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant B3GNT3.
Información adicional
Size 100 ug
Gene Name B3GNT3
Gene Alias B3GAL-T8|B3GN-T3|B3GNT-3|HP10328|TMEM3|beta3Gn-T3
Gene Description UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen B3GNT3 (NP_055071, 135 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10331
Clone Number 1A2
Iso type IgG2a Kappa

Enviar uma mensagem


B3GNT3 monoclonal antibody (M01), clone 1A2

B3GNT3 monoclonal antibody (M01), clone 1A2