B3GNT3 polyclonal antibody (A01)
  • B3GNT3 polyclonal antibody (A01)

B3GNT3 polyclonal antibody (A01)

Ref: AB-H00010331-A01
B3GNT3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant B3GNT3.
Información adicional
Size 50 uL
Gene Name B3GNT3
Gene Alias B3GAL-T8|B3GN-T3|B3GNT-3|HP10328|TMEM3|beta3Gn-T3
Gene Description UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen B3GNT3 (NP_055071, 135 a.a. ~ 208 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10331

Enviar uma mensagem


B3GNT3 polyclonal antibody (A01)

B3GNT3 polyclonal antibody (A01)