B3GALT5 polyclonal antibody (A01)
  • B3GALT5 polyclonal antibody (A01)

B3GALT5 polyclonal antibody (A01)

Ref: AB-H00010317-A01
B3GALT5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant B3GALT5.
Información adicional
Size 50 uL
Gene Name B3GALT5
Gene Alias B3GalT-V|B3GalTx|B3T5|GLCT5|beta3Gal-T5
Gene Description UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen B3GALT5 (NP_006048, 29 a.a. ~ 128 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10317

Enviar uma mensagem


B3GALT5 polyclonal antibody (A01)

B3GALT5 polyclonal antibody (A01)