MARCH6 polyclonal antibody (A01)
  • MARCH6 polyclonal antibody (A01)

MARCH6 polyclonal antibody (A01)

Ref: AB-H00010299-A01
MARCH6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MARCH6.
Información adicional
Size 50 uL
Gene Name MARCH6
Gene Alias KIAA0597|MARCH-VI|RNF176|TEB4
Gene Description membrane-associated ring finger (C3HC4) 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq DTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPSRLPIQDIFAGLVTSIGTAIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen 40974 (NP_005876, 2 a.a. ~ 91 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10299

Enviar uma mensagem


MARCH6 polyclonal antibody (A01)

MARCH6 polyclonal antibody (A01)