PAK4 monoclonal antibody (M01), clone 3F10
  • PAK4 monoclonal antibody (M01), clone 3F10

PAK4 monoclonal antibody (M01), clone 3F10

Ref: AB-H00010298-M01
PAK4 monoclonal antibody (M01), clone 3F10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PAK4.
Información adicional
Size 100 ug
Gene Name PAK4
Gene Alias -
Gene Description p21 protein (Cdc42/Rac)-activated kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEKPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAK4 (AAH02921, 68 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10298
Clone Number 3F10
Iso type IgG1 Kappa

Enviar uma mensagem


PAK4 monoclonal antibody (M01), clone 3F10

PAK4 monoclonal antibody (M01), clone 3F10