LILRB2 purified MaxPab rabbit polyclonal antibody (D01P)
  • LILRB2 purified MaxPab rabbit polyclonal antibody (D01P)

LILRB2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010288-D01P
LILRB2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LILRB2 protein.
Información adicional
Size 100 ug
Gene Name LILRB2
Gene Alias CD85D|ILT4|LILRA6|LIR-2|LIR2|MIR-10|MIR10
Gene Description leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRRV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LILRB2 (AAH41708.1, 1 a.a. ~ 193 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10288

Enviar uma mensagem


LILRB2 purified MaxPab rabbit polyclonal antibody (D01P)

LILRB2 purified MaxPab rabbit polyclonal antibody (D01P)