View larger
Mouse monoclonal antibody raised against a full length recombinant SAP18.
AB-H00010284-M01
New product
SAP18 monoclonal antibody (M01), clone 3B2
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | SAP18 |
| Gene Alias | 2HOR0202|MGC27131|SAP18P |
| Gene Description | Sin3A-associated protein, 18kDa |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPTSGRMRPY |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SAP18 (AAH30836, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 10284 |
| Clone Number | 3B2 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a full length recombinant SAP18.