UBE4B monoclonal antibody (M02), clone 1D5
  • UBE4B monoclonal antibody (M02), clone 1D5

UBE4B monoclonal antibody (M02), clone 1D5

Ref: AB-H00010277-M02
UBE4B monoclonal antibody (M02), clone 1D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UBE4B.
Información adicional
Size 50 ug
Gene Name UBE4B
Gene Alias E4|HDNB1|KIAA0684|UBOX3|UFD2
Gene Description ubiquitination factor E4B (UFD2 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE4B (NP_006039, 1075 a.a. ~ 1173 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10277
Clone Number 1D5
Iso type IgG2a Kappa

Enviar uma mensagem


UBE4B monoclonal antibody (M02), clone 1D5

UBE4B monoclonal antibody (M02), clone 1D5