UBE4B polyclonal antibody (A01)
  • UBE4B polyclonal antibody (A01)

UBE4B polyclonal antibody (A01)

Ref: AB-H00010277-A01
UBE4B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UBE4B.
Información adicional
Size 50 uL
Gene Name UBE4B
Gene Alias E4|HDNB1|KIAA0684|UBOX3|UFD2
Gene Description ubiquitination factor E4B (UFD2 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq FKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE4B (NP_006039, 1075 a.a. ~ 1173 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10277

Enviar uma mensagem


UBE4B polyclonal antibody (A01)

UBE4B polyclonal antibody (A01)