STUB1 monoclonal antibody (M01), clone 2E12 View larger

Mouse monoclonal antibody raised against a partial recombinant STUB1.

AB-H00010273-M01

New product

STUB1 monoclonal antibody (M01), clone 2E12

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name STUB1
Gene Alias CHIP|HSPABP2|NY-CO-7|SDCCAG7|UBOX1
Gene Description STIP1 homology and U-box containing protein 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STUB1 (NP_005852.2, 204 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10273
Clone Number 2E12
Iso type IgG2a Lambda

More info

Mouse monoclonal antibody raised against a partial recombinant STUB1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant STUB1.

Mouse monoclonal antibody raised against a partial recombinant STUB1.