Size
100 ug
Gene Name
AKAP8
Gene Alias
AKAP95|DKFZp586B1222
Gene Description
A kinase (PRKA) anchor protein 8
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Tr,WB-Re,IHC-P,IP,S-ELISA,ELISA,IF
Immunogen Prot. Seq
VDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAES
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AKAP8 (NP_005849, 551 a.a. ~ 662 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
10270
Clone Number
3D4
Iso type
IgG2a Kappa