RAMP3 monoclonal antibody (M01), clone 1C11
  • RAMP3 monoclonal antibody (M01), clone 1C11

RAMP3 monoclonal antibody (M01), clone 1C11

Ref: AB-H00010268-M01
RAMP3 monoclonal antibody (M01), clone 1C11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant RAMP3.
Información adicional
Size 100 ug
Gene Name RAMP3
Gene Alias -
Gene Description receptor (G protein-coupled) activity modifying protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAMP3 (AAH22304.1, 24 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10268
Clone Number 1C11
Iso type IgG1 kappa

Enviar uma mensagem


RAMP3 monoclonal antibody (M01), clone 1C11

RAMP3 monoclonal antibody (M01), clone 1C11