RAMP1 monoclonal antibody (M04), clone 3B9
  • RAMP1 monoclonal antibody (M04), clone 3B9

RAMP1 monoclonal antibody (M04), clone 3B9

Ref: AB-H00010267-M04
RAMP1 monoclonal antibody (M04), clone 3B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAMP1.
Información adicional
Size 100 ug
Gene Name RAMP1
Gene Alias -
Gene Description receptor (G protein-coupled) activity modifying protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAMP1 (NP_005846, 27 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10267
Clone Number 3B9
Iso type IgG2b Kappa

Enviar uma mensagem


RAMP1 monoclonal antibody (M04), clone 3B9

RAMP1 monoclonal antibody (M04), clone 3B9