RAMP1 monoclonal antibody (M01), clone 1F1
  • RAMP1 monoclonal antibody (M01), clone 1F1

RAMP1 monoclonal antibody (M01), clone 1F1

Ref: AB-H00010267-M01
RAMP1 monoclonal antibody (M01), clone 1F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAMP1.
Información adicional
Size 100 ug
Gene Name RAMP1
Gene Alias -
Gene Description receptor (G protein-coupled) activity modifying protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAMP1 (NP_005846, 27 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10267
Clone Number 1F1
Iso type IgG2b Kappa

Enviar uma mensagem


RAMP1 monoclonal antibody (M01), clone 1F1

RAMP1 monoclonal antibody (M01), clone 1F1