CDK2AP2 purified MaxPab mouse polyclonal antibody (B01P)
  • CDK2AP2 purified MaxPab mouse polyclonal antibody (B01P)

CDK2AP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010263-B01P
CDK2AP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CDK2AP2 protein.
Información adicional
Size 50 ug
Gene Name CDK2AP2
Gene Alias DOC-1R|FLJ10636|p14
Gene Description cyclin-dependent kinase 2 associated protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDK2AP2 (AAH02850, 1 a.a. ~ 126 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10263

Enviar uma mensagem


CDK2AP2 purified MaxPab mouse polyclonal antibody (B01P)

CDK2AP2 purified MaxPab mouse polyclonal antibody (B01P)