DENND4A polyclonal antibody (A01)
  • DENND4A polyclonal antibody (A01)

DENND4A polyclonal antibody (A01)

Ref: AB-H00010260-A01
DENND4A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DENND4A.
Información adicional
Size 50 uL
Gene Name DENND4A
Gene Alias FLJ33949|IRLB|KIAA0476|MYCPBP
Gene Description DENN/MADD domain containing 4A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MIEDKGPRVADYFVVAGLTDVSKPLEEEIHFNDACHKVAKPKEPITDVSVIIKSLGEEVPQDYICIDVTPTGLSADLNNGSLVGPQIYLCYRRGRDKPPLT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DENND4A (NP_005839, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10260

Enviar uma mensagem


DENND4A polyclonal antibody (A01)

DENND4A polyclonal antibody (A01)