CNKSR1 polyclonal antibody (A01)
  • CNKSR1 polyclonal antibody (A01)

CNKSR1 polyclonal antibody (A01)

Ref: AB-H00010256-A01
CNKSR1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CNKSR1.
Información adicional
Size 50 uL
Gene Name CNKSR1
Gene Alias CNK|CNK1|KSR
Gene Description connector enhancer of kinase suppressor of Ras 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VLCAAVELLHEADALLFWLSRYLFSHLNDFSACQEIRDLLEELSQVLHEDGPAAEKEGTVLRICSHVAGICHNILVCCPKELLEQKAVLEQVQLDSPLGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNKSR1 (NP_006305, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10256

Enviar uma mensagem


CNKSR1 polyclonal antibody (A01)

CNKSR1 polyclonal antibody (A01)