STAM2 polyclonal antibody (A01)
  • STAM2 polyclonal antibody (A01)

STAM2 polyclonal antibody (A01)

Ref: AB-H00010254-A01
STAM2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant STAM2.
Información adicional
Size 50 uL
Gene Name STAM2
Gene Alias DKFZp564C047|Hbp|STAM2A|STAM2B
Gene Description signal transducing adaptor molecule (SH3 domain and ITAM motif) 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QSYSLGPDQIGPLRSLPPNVNSSVTAQPAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQPLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAM2 (NP_005834, 416 a.a. ~ 525 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10254

Enviar uma mensagem


STAM2 polyclonal antibody (A01)

STAM2 polyclonal antibody (A01)