POP7 purified MaxPab mouse polyclonal antibody (B01P)
  • POP7 purified MaxPab mouse polyclonal antibody (B01P)

POP7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010248-B01P
POP7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human POP7 protein.
Información adicional
Size 50 ug
Gene Name POP7
Gene Alias 0610037N12Rik|RPP2|RPP20
Gene Description processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen POP7 (AAH01430, 1 a.a. ~ 140 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10248

Enviar uma mensagem


POP7 purified MaxPab mouse polyclonal antibody (B01P)

POP7 purified MaxPab mouse polyclonal antibody (B01P)