RABEPK monoclonal antibody (M01), clone 4C9
  • RABEPK monoclonal antibody (M01), clone 4C9

RABEPK monoclonal antibody (M01), clone 4C9

Ref: AB-H00010244-M01
RABEPK monoclonal antibody (M01), clone 4C9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RABEPK.
Información adicional
Size 100 ug
Gene Name RABEPK
Gene Alias DKFZp686P1077|RAB9P40|bA65N13.1|p40
Gene Description Rab9 effector protein with kelch motifs
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YHTEEQHWTLLKFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVVD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RABEPK (NP_005824.2, 273 a.a. ~ 372 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10244
Clone Number 4C9
Iso type IgG2a Kappa

Enviar uma mensagem


RABEPK monoclonal antibody (M01), clone 4C9

RABEPK monoclonal antibody (M01), clone 4C9