CALCOCO2 monoclonal antibody (M07), clone 1A11
  • CALCOCO2 monoclonal antibody (M07), clone 1A11

CALCOCO2 monoclonal antibody (M07), clone 1A11

Ref: AB-H00010241-M07
CALCOCO2 monoclonal antibody (M07), clone 1A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CALCOCO2.
Información adicional
Size 100 ug
Gene Name CALCOCO2
Gene Alias MGC17318|NDP52
Gene Description calcium binding and coiled-coil domain 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq SYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CALCOCO2 (NP_005822, 347 a.a. ~ 446 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10241
Clone Number 1A11
Iso type IgG2b Kappa

Enviar uma mensagem


CALCOCO2 monoclonal antibody (M07), clone 1A11

CALCOCO2 monoclonal antibody (M07), clone 1A11