LRRC17 purified MaxPab mouse polyclonal antibody (B01P)
  • LRRC17 purified MaxPab mouse polyclonal antibody (B01P)

LRRC17 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010234-B01P
LRRC17 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LRRC17 protein.
Información adicional
Size 50 ug
Gene Name LRRC17
Gene Alias P37NB
Gene Description leucine rich repeat containing 17
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRVVTIVILLCFCKAAELRKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYLHEKYLDCQERKLVYVLPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKPEVDSTFCHNYVFPIQTLDCK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LRRC17 (NP_001026862.1, 1 a.a. ~ 441 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10234

Enviar uma mensagem


LRRC17 purified MaxPab mouse polyclonal antibody (B01P)

LRRC17 purified MaxPab mouse polyclonal antibody (B01P)