MSLN purified MaxPab rabbit polyclonal antibody (D01P)
  • MSLN purified MaxPab rabbit polyclonal antibody (D01P)

MSLN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010232-D01P
MSLN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MSLN protein.
Información adicional
Size 100 ug
Gene Name MSLN
Gene Alias CAK1|MPF|SMR
Gene Description mesothelin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALPTARPLLGSCGTPALGSLLFLLFSLGWVQPSRTLAGETGQAAPLDGVLANPPNISSLSPRQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTWSVSTMDALRGLLPVLG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MSLN (AAH03512.1, 1 a.a. ~ 621 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10232

Enviar uma mensagem


MSLN purified MaxPab rabbit polyclonal antibody (D01P)

MSLN purified MaxPab rabbit polyclonal antibody (D01P)