MSLN MaxPab rabbit polyclonal antibody (D01)
  • MSLN MaxPab rabbit polyclonal antibody (D01)

MSLN MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010232-D01
MSLN MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MSLN protein.
Información adicional
Size 100 uL
Gene Name MSLN
Gene Alias CAK1|MPF|SMR
Gene Description mesothelin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MALPTARPLLGSCGTPALGSLLFLLFSLGWVQPSRTLAGETGQAAPLDGVLANPPNISSLSPRQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTWSVSTMDALRGLLPVLG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MSLN (AAH03512.1, 1 a.a. ~ 621 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10232

Enviar uma mensagem


MSLN MaxPab rabbit polyclonal antibody (D01)

MSLN MaxPab rabbit polyclonal antibody (D01)