ANGPTL7 monoclonal antibody (M07), clone 3A9
  • ANGPTL7 monoclonal antibody (M07), clone 3A9

ANGPTL7 monoclonal antibody (M07), clone 3A9

Ref: AB-H00010218-M07
ANGPTL7 monoclonal antibody (M07), clone 3A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ANGPTL7.
Información adicional
Size 100 ug
Gene Name ANGPTL7
Gene Alias AngX|CDT6|RP4-647M16.2|dJ647M16.1
Gene Description angiopoietin-like 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSAD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ANGPTL7 (NP_066969, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10218
Clone Number 3A9
Iso type IgG2a Kappa

Enviar uma mensagem


ANGPTL7 monoclonal antibody (M07), clone 3A9

ANGPTL7 monoclonal antibody (M07), clone 3A9