PSMD14 purified MaxPab mouse polyclonal antibody (B02P)
  • PSMD14 purified MaxPab mouse polyclonal antibody (B02P)

PSMD14 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00010213-B02P
PSMD14 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PSMD14 protein.
Información adicional
Size 50 ug
Gene Name PSMD14
Gene Alias PAD1|POH1|rpn11
Gene Description proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PSMD14 (NP_005796.1, 1 a.a. ~ 310 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10213

Enviar uma mensagem


PSMD14 purified MaxPab mouse polyclonal antibody (B02P)

PSMD14 purified MaxPab mouse polyclonal antibody (B02P)