PSMD14 polyclonal antibody (A01)
  • PSMD14 polyclonal antibody (A01)

PSMD14 polyclonal antibody (A01)

Ref: AB-H00010213-A01
PSMD14 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PSMD14.
Información adicional
Size 50 uL
Gene Name PSMD14
Gene Alias PAD1|POH1|rpn11
Gene Description proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSMD14 (AAH09524.1, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10213

Enviar uma mensagem


PSMD14 polyclonal antibody (A01)

PSMD14 polyclonal antibody (A01)