TOPORS monoclonal antibody (M14A), clone 5G9
  • TOPORS monoclonal antibody (M14A), clone 5G9

TOPORS monoclonal antibody (M14A), clone 5G9

Ref: AB-H00010210-M14A
TOPORS monoclonal antibody (M14A), clone 5G9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Información adicional
Size 200 uL
Gene Name TOPORS
Gene Alias LUN|P53BP3|RP31|TP53BPL
Gene Description topoisomerase I binding, arginine/serine-rich
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOPORS (NP_005793, 98 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 10210
Clone Number 5G9
Iso type IgG2a Kappa

Enviar uma mensagem


TOPORS monoclonal antibody (M14A), clone 5G9

TOPORS monoclonal antibody (M14A), clone 5G9