TOPORS monoclonal antibody (M02), clone 4G4
  • TOPORS monoclonal antibody (M02), clone 4G4

TOPORS monoclonal antibody (M02), clone 4G4

Ref: AB-H00010210-M02
TOPORS monoclonal antibody (M02), clone 4G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Información adicional
Size 100 ug
Gene Name TOPORS
Gene Alias LUN|P53BP3|RP31|TP53BPL
Gene Description topoisomerase I binding, arginine/serine-rich
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOPORS (NP_005793, 98 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10210
Clone Number 4G4
Iso type IgG2a Kappa

Enviar uma mensagem


TOPORS monoclonal antibody (M02), clone 4G4

TOPORS monoclonal antibody (M02), clone 4G4