EIF1 monoclonal antibody (M01A), clone 2E1
  • EIF1 monoclonal antibody (M01A), clone 2E1

EIF1 monoclonal antibody (M01A), clone 2E1

Ref: AB-H00010209-M01A
EIF1 monoclonal antibody (M01A), clone 2E1

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant EIF1.
Información adicional
Size 200 uL
Gene Name EIF1
Gene Alias A121|EIF-1|EIF1A|ISO1|SUI1
Gene Description eukaryotic translation initiation factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF1 (AAH05118, 1 a.a. ~ 113 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 10209
Clone Number 2E1
Iso type IgM Kappa

Enviar uma mensagem


EIF1 monoclonal antibody (M01A), clone 2E1

EIF1 monoclonal antibody (M01A), clone 2E1