RFP2 polyclonal antibody (A01)
  • RFP2 polyclonal antibody (A01)

RFP2 polyclonal antibody (A01)

Ref: AB-H00010206-A01
RFP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RFP2.
Información adicional
Size 50 uL
Gene Name TRIM13
Gene Alias CAR|DLEU5|LEU5|RFP2|RNF77
Gene Description tripartite motif-containing 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RFP2 (NP_005789, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10206

Enviar uma mensagem


RFP2 polyclonal antibody (A01)

RFP2 polyclonal antibody (A01)