NME6 purified MaxPab mouse polyclonal antibody (B03P)
  • NME6 purified MaxPab mouse polyclonal antibody (B03P)

NME6 purified MaxPab mouse polyclonal antibody (B03P)

Ref: AB-H00010201-B03P
NME6 purified MaxPab mouse polyclonal antibody (B03P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NME6 protein.
Información adicional
Size 50 ug
Gene Name NME6
Gene Alias IPIA-ALPHA|NM23-H6
Gene Description non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NME6 (AAH01808.1, 1 a.a. ~ 194 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10201

Enviar uma mensagem


NME6 purified MaxPab mouse polyclonal antibody (B03P)

NME6 purified MaxPab mouse polyclonal antibody (B03P)