MPHOSPH6 monoclonal antibody (M11), clone 4F11
  • MPHOSPH6 monoclonal antibody (M11), clone 4F11

MPHOSPH6 monoclonal antibody (M11), clone 4F11

Ref: AB-H00010200-M11
MPHOSPH6 monoclonal antibody (M11), clone 4F11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MPHOSPH6.
Información adicional
Size 100 ug
Gene Name MPHOSPH6
Gene Alias MPP|MPP-6|MPP6
Gene Description M-phase phosphoprotein 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAAERKTKLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPHOSPH6 (AAH05242, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10200
Clone Number 4F11
Iso type IgG2a Kappa

Enviar uma mensagem


MPHOSPH6 monoclonal antibody (M11), clone 4F11

MPHOSPH6 monoclonal antibody (M11), clone 4F11