MPHOSPH10 monoclonal antibody (M02), clone 1B10
  • MPHOSPH10 monoclonal antibody (M02), clone 1B10

MPHOSPH10 monoclonal antibody (M02), clone 1B10

Ref: AB-H00010199-M02
MPHOSPH10 monoclonal antibody (M02), clone 1B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MPHOSPH10.
Información adicional
Size 100 ug
Gene Name MPHOSPH10
Gene Alias MPP10|MPP10P
Gene Description M-phase phosphoprotein 10 (U3 small nucleolar ribonucleoprotein)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq NVKKNSDEVKSSFEKRQEKMNEKIASLEKELLEKKPWQLQGEVTAQKRPENSLLEETLHFDHAVRMAPVITEETTLQLEDIIKQRIRDQAWDDVVRKEKPKEDAYEYKKR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPHOSPH10 (NP_005782, 348 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10199
Clone Number 1B10
Iso type IgG1 Kappa

Enviar uma mensagem


MPHOSPH10 monoclonal antibody (M02), clone 1B10

MPHOSPH10 monoclonal antibody (M02), clone 1B10