MPHOSPH9 monoclonal antibody (M10), clone 4E10
  • MPHOSPH9 monoclonal antibody (M10), clone 4E10

MPHOSPH9 monoclonal antibody (M10), clone 4E10

Ref: AB-H00010198-M10
MPHOSPH9 monoclonal antibody (M10), clone 4E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MPHOSPH9.
Información adicional
Size 100 ug
Gene Name MPHOSPH9
Gene Alias DKFZp434J034|FLJ12954|MPP-9|MPP9
Gene Description M-phase phosphoprotein 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq SVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDELTKEKDQIEAALSRMPSPGGRITLQTRLNQEALEDRLERINRELGSVRMTLKKFHVLRTSANL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPHOSPH9 (NP_073619, 922 a.a. ~ 1031 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10198
Clone Number 4E10
Iso type IgG2a Kappa

Enviar uma mensagem


MPHOSPH9 monoclonal antibody (M10), clone 4E10

MPHOSPH9 monoclonal antibody (M10), clone 4E10