MPHOSPH9 polyclonal antibody (A01)
  • MPHOSPH9 polyclonal antibody (A01)

MPHOSPH9 polyclonal antibody (A01)

Ref: AB-H00010198-A01
MPHOSPH9 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MPHOSPH9.
Información adicional
Size 50 uL
Gene Name MPHOSPH9
Gene Alias DKFZp434J034|FLJ12954|MPP-9|MPP9
Gene Description M-phase phosphoprotein 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDELTKEKDQIEAALSRMPSPGGRITLQTRLNQEALEDRLERINRELGSVRMTLKKFHVLRTSANL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPHOSPH9 (NP_073619, 922 a.a. ~ 1031 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10198

Enviar uma mensagem


MPHOSPH9 polyclonal antibody (A01)

MPHOSPH9 polyclonal antibody (A01)