TSHZ1 purified MaxPab mouse polyclonal antibody (B01P)
  • TSHZ1 purified MaxPab mouse polyclonal antibody (B01P)

TSHZ1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010194-B01P
TSHZ1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TSHZ1 protein.
Información adicional
Size 50 ug
Gene Name TSHZ1
Gene Alias NY-CO-33|SDCCAG33|TSH1
Gene Description teashirt zinc finger homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MCNEETEIKEAQSYQNSPVSSATNQDAGYGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSYPQDSLAQIKAVYANLFSESCWSSLALDLKKSGSTTSTNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTSCSSSTSHSSTTSTSSSSGYDWHQAALAKTLQQTSSYGLLPEPSLFSTVQLYRQNNKLYGSVFTGASKFRCKDCSAAYDTLVELTVHMNETGHYRDDNRDKDSEKTKRWSKPRKRSLMEMEGK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TSHZ1 (AAI56589.1, 1 a.a. ~ 1032 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10194

Enviar uma mensagem


TSHZ1 purified MaxPab mouse polyclonal antibody (B01P)

TSHZ1 purified MaxPab mouse polyclonal antibody (B01P)