TNK2 polyclonal antibody (A01)
  • TNK2 polyclonal antibody (A01)

TNK2 polyclonal antibody (A01)

Ref: AB-H00010188-A01
TNK2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TNK2.
Información adicional
Size 50 uL
Gene Name TNK2
Gene Alias ACK|ACK1|FLJ44758|FLJ45547|p21cdc42Hs
Gene Description tyrosine kinase, non-receptor, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNK2 (AAH08884, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10188

Enviar uma mensagem


TNK2 polyclonal antibody (A01)

TNK2 polyclonal antibody (A01)