FARP1 monoclonal antibody (M01), clone 2D4
  • FARP1 monoclonal antibody (M01), clone 2D4

FARP1 monoclonal antibody (M01), clone 2D4

Ref: AB-H00010160-M01
FARP1 monoclonal antibody (M01), clone 2D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FARP1.
Información adicional
Size 100 ug
Gene Name FARP1
Gene Alias CDEP|MGC87400|PLEKHC2
Gene Description FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq TGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDKAYFIAKEVS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FARP1 (NP_005757.1, 471 a.a. ~ 549 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10160
Clone Number 2D4
Iso type IgG2a Kappa

Enviar uma mensagem


FARP1 monoclonal antibody (M01), clone 2D4

FARP1 monoclonal antibody (M01), clone 2D4