PDZK1IP1 monoclonal antibody (M06), clone 4D11
  • PDZK1IP1 monoclonal antibody (M06), clone 4D11

PDZK1IP1 monoclonal antibody (M06), clone 4D11

Ref: AB-H00010158-M06
PDZK1IP1 monoclonal antibody (M06), clone 4D11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PDZK1IP1.
Información adicional
Size 100 ug
Gene Name PDZK1IP1
Gene Alias DD96|MAP17|RP1-18D14.5|SPAP
Gene Description PDZK1 interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDZK1IP1 (NP_005755.1, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10158
Clone Number 4D11
Iso type IgG2a Kappa

Enviar uma mensagem


PDZK1IP1 monoclonal antibody (M06), clone 4D11

PDZK1IP1 monoclonal antibody (M06), clone 4D11