EBI3 monoclonal antibody (M01), clone 1D3
  • EBI3 monoclonal antibody (M01), clone 1D3

EBI3 monoclonal antibody (M01), clone 1D3

Ref: AB-H00010148-M01
EBI3 monoclonal antibody (M01), clone 1D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EBI3. (Please notice that this antibody can't conjugate with biotin, biotinylation will lead to lost of antibody specificity).
Información adicional
Size 100 ug
Gene Name EBI3
Gene Alias IL27B
Gene Description Epstein-Barr virus induced 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq PDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EBI3 (NP_005746, 129 a.a. ~ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10148
Clone Number 1D3
Iso type IgG2a Kappa

Enviar uma mensagem


EBI3 monoclonal antibody (M01), clone 1D3

EBI3 monoclonal antibody (M01), clone 1D3