AKAP9 monoclonal antibody (M07), clone 7E12
  • AKAP9 monoclonal antibody (M07), clone 7E12

AKAP9 monoclonal antibody (M07), clone 7E12

Ref: AB-H00010142-M07
AKAP9 monoclonal antibody (M07), clone 7E12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AKAP9.
Información adicional
Size 100 ug
Gene Name AKAP9
Gene Alias AKAP350|AKAP450|CG-NAP|HYPERION|KIAA0803|MU-RMS-40.16A|PRKA9|YOTIAO
Gene Description A kinase (PRKA) anchor protein (yotiao) 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq EKTDSFYHSSGGLELYGEPRHTTYRSRSDLDYIRSPLPFQNRYPGTPADFNPGSLACSQLQNYDPDRALTDYITRLEALQRRLGTIQSGSTTQFHAGMRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AKAP9 (NP_671700, 3812 a.a. ~ 3911 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10142
Clone Number 7E12
Iso type IgG2a Kappa

Enviar uma mensagem


AKAP9 monoclonal antibody (M07), clone 7E12

AKAP9 monoclonal antibody (M07), clone 7E12