TOB1 purified MaxPab mouse polyclonal antibody (B01P)
  • TOB1 purified MaxPab mouse polyclonal antibody (B01P)

TOB1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010140-B01P
TOB1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TOB1 protein.
Información adicional
Size 50 ug
Gene Name TOB1
Gene Alias APRO6|MGC104792|MGC34446|PIG49|TOB|TROB|TROB1
Gene Description transducer of ERBB2, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TOB1 (NP_005740.1, 1 a.a. ~ 345 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10140

Enviar uma mensagem


TOB1 purified MaxPab mouse polyclonal antibody (B01P)

TOB1 purified MaxPab mouse polyclonal antibody (B01P)