ARFRP1 polyclonal antibody (A01)
  • ARFRP1 polyclonal antibody (A01)

ARFRP1 polyclonal antibody (A01)

Ref: AB-H00010139-A01
ARFRP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ARFRP1.
Información adicional
Size 50 uL
Gene Name ARFRP1
Gene Alias ARL18|ARP|Arp1
Gene Description ADP-ribosylation factor related protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq ANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARFRP1 (NP_003215, 133 a.a. ~ 201 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10139

Enviar uma mensagem


ARFRP1 polyclonal antibody (A01)

ARFRP1 polyclonal antibody (A01)