YAF2 purified MaxPab mouse polyclonal antibody (B01P)
  • YAF2 purified MaxPab mouse polyclonal antibody (B01P)

YAF2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010138-B01P
YAF2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human YAF2 protein.
Información adicional
Size 50 ug
Gene Name YAF2
Gene Alias MGC41856
Gene Description YY1 associated factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen YAF2 (NP_005739.2, 1 a.a. ~ 180 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10138

Enviar uma mensagem


YAF2 purified MaxPab mouse polyclonal antibody (B01P)

YAF2 purified MaxPab mouse polyclonal antibody (B01P)