RBM12 monoclonal antibody (M05), clone 1D12
  • RBM12 monoclonal antibody (M05), clone 1D12

RBM12 monoclonal antibody (M05), clone 1D12

Ref: AB-H00010137-M05
RBM12 monoclonal antibody (M05), clone 1D12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RBM12.
Información adicional
Size 100 ug
Gene Name RBM12
Gene Alias HRIHFB2091|KIAA0765|SWAN
Gene Description RNA binding motif protein 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GPGPIHIGGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBM12 (NP_006038.2, 834 a.a. ~ 932 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10137
Clone Number 1D12
Iso type IgG1 Kappa

Enviar uma mensagem


RBM12 monoclonal antibody (M05), clone 1D12

RBM12 monoclonal antibody (M05), clone 1D12